Anti FICD pAb (ATL-HPA071134)

Atlas Antibodies

Catalog No.:
ATL-HPA071134-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: FIC domain containing
Gene Name: FICD
Alternative Gene Name: HIP13, HYPE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053334: 97%, ENSRNOG00000059799: 93%
Entrez Gene ID: 11153
Uniprot ID: Q9BVA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKKVMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISD
Gene Sequence VKKVMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISD
Gene ID - Mouse ENSMUSG00000053334
Gene ID - Rat ENSRNOG00000059799
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FICD pAb (ATL-HPA071134)
Datasheet Anti FICD pAb (ATL-HPA071134) Datasheet (External Link)
Vendor Page Anti FICD pAb (ATL-HPA071134) at Atlas Antibodies

Documents & Links for Anti FICD pAb (ATL-HPA071134)
Datasheet Anti FICD pAb (ATL-HPA071134) Datasheet (External Link)
Vendor Page Anti FICD pAb (ATL-HPA071134)