Anti FICD pAb (ATL-HPA071134)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071134-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: FICD
Alternative Gene Name: HIP13, HYPE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053334: 97%, ENSRNOG00000059799: 93%
Entrez Gene ID: 11153
Uniprot ID: Q9BVA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VKKVMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISD |
Gene Sequence | VKKVMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISD |
Gene ID - Mouse | ENSMUSG00000053334 |
Gene ID - Rat | ENSRNOG00000059799 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FICD pAb (ATL-HPA071134) | |
Datasheet | Anti FICD pAb (ATL-HPA071134) Datasheet (External Link) |
Vendor Page | Anti FICD pAb (ATL-HPA071134) at Atlas Antibodies |
Documents & Links for Anti FICD pAb (ATL-HPA071134) | |
Datasheet | Anti FICD pAb (ATL-HPA071134) Datasheet (External Link) |
Vendor Page | Anti FICD pAb (ATL-HPA071134) |