Anti FICD pAb (ATL-HPA021390)

Atlas Antibodies

SKU:
ATL-HPA021390-25
  • Immunohistochemical staining of human Testis shows strong granular cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FIC domain containing
Gene Name: FICD
Alternative Gene Name: HIP13, HYPE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053334: 83%, ENSRNOG00000059799: 85%
Entrez Gene ID: 11153
Uniprot ID: Q9BVA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CLAVLKGLYLLRSKPDRAQHAATKCTSPSTELSITSRGATLLVAKTKASPAGKLEARAALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIID
Gene Sequence CLAVLKGLYLLRSKPDRAQHAATKCTSPSTELSITSRGATLLVAKTKASPAGKLEARAALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIID
Gene ID - Mouse ENSMUSG00000053334
Gene ID - Rat ENSRNOG00000059799
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FICD pAb (ATL-HPA021390)
Datasheet Anti FICD pAb (ATL-HPA021390) Datasheet (External Link)
Vendor Page Anti FICD pAb (ATL-HPA021390) at Atlas Antibodies

Documents & Links for Anti FICD pAb (ATL-HPA021390)
Datasheet Anti FICD pAb (ATL-HPA021390) Datasheet (External Link)
Vendor Page Anti FICD pAb (ATL-HPA021390)