Anti FIBP pAb (ATL-HPA011729 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA011729-25
  • Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nuclear speckles.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and FIBP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY404773).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: fibroblast growth factor (acidic) intracellular binding protein
Gene Name: FIBP
Alternative Gene Name: FGFIBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024911: 97%, ENSRNOG00000020567: 97%
Entrez Gene ID: 9158
Uniprot ID: O43427
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSL
Gene Sequence VRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSL
Gene ID - Mouse ENSMUSG00000024911
Gene ID - Rat ENSRNOG00000020567
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FIBP pAb (ATL-HPA011729 w/enhanced validation)
Datasheet Anti FIBP pAb (ATL-HPA011729 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FIBP pAb (ATL-HPA011729 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FIBP pAb (ATL-HPA011729 w/enhanced validation)
Datasheet Anti FIBP pAb (ATL-HPA011729 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FIBP pAb (ATL-HPA011729 w/enhanced validation)