Anti FGFRL1 pAb (ATL-HPA068828)

Atlas Antibodies

Catalog No.:
ATL-HPA068828-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: fibroblast growth factor receptor-like 1
Gene Name: FGFRL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008090: 92%, ENSRNOG00000024207: 89%
Entrez Gene ID: 53834
Uniprot ID: Q8N441
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVAS
Gene Sequence KATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVAS
Gene ID - Mouse ENSMUSG00000008090
Gene ID - Rat ENSRNOG00000024207
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FGFRL1 pAb (ATL-HPA068828)
Datasheet Anti FGFRL1 pAb (ATL-HPA068828) Datasheet (External Link)
Vendor Page Anti FGFRL1 pAb (ATL-HPA068828) at Atlas Antibodies

Documents & Links for Anti FGFRL1 pAb (ATL-HPA068828)
Datasheet Anti FGFRL1 pAb (ATL-HPA068828) Datasheet (External Link)
Vendor Page Anti FGFRL1 pAb (ATL-HPA068828)