Anti FGFR4 pAb (ATL-HPA028251)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028251-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FGFR4
Alternative Gene Name: CD334, JTK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005320: 90%, ENSRNOG00000016763: 87%
Entrez Gene ID: 2264
Uniprot ID: P22455
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLP |
| Gene Sequence | EEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLP |
| Gene ID - Mouse | ENSMUSG00000005320 |
| Gene ID - Rat | ENSRNOG00000016763 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FGFR4 pAb (ATL-HPA028251) | |
| Datasheet | Anti FGFR4 pAb (ATL-HPA028251) Datasheet (External Link) |
| Vendor Page | Anti FGFR4 pAb (ATL-HPA028251) at Atlas Antibodies |
| Documents & Links for Anti FGFR4 pAb (ATL-HPA028251) | |
| Datasheet | Anti FGFR4 pAb (ATL-HPA028251) Datasheet (External Link) |
| Vendor Page | Anti FGFR4 pAb (ATL-HPA028251) |
| Citations for Anti FGFR4 pAb (ATL-HPA028251) – 1 Found |
| Soady, Kelly J; Tornillo, Giusy; Kendrick, Howard; Meniel, Valerie; Olijnyk-Dallis, Daria; Morris, Joanna S; Stein, Torsten; Gusterson, Barry A; Isacke, Clare M; Smalley, Matthew J. The receptor protein tyrosine phosphatase PTPRB negatively regulates FGF2-dependent branching morphogenesis. Development (Cambridge, England). 2017;144(20):3777-3788. PubMed |