Anti FGFR4 pAb (ATL-HPA028251)

Atlas Antibodies

Catalog No.:
ATL-HPA028251-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: fibroblast growth factor receptor 4
Gene Name: FGFR4
Alternative Gene Name: CD334, JTK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005320: 90%, ENSRNOG00000016763: 87%
Entrez Gene ID: 2264
Uniprot ID: P22455
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLP
Gene Sequence EEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLP
Gene ID - Mouse ENSMUSG00000005320
Gene ID - Rat ENSRNOG00000016763
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FGFR4 pAb (ATL-HPA028251)
Datasheet Anti FGFR4 pAb (ATL-HPA028251) Datasheet (External Link)
Vendor Page Anti FGFR4 pAb (ATL-HPA028251) at Atlas Antibodies

Documents & Links for Anti FGFR4 pAb (ATL-HPA028251)
Datasheet Anti FGFR4 pAb (ATL-HPA028251) Datasheet (External Link)
Vendor Page Anti FGFR4 pAb (ATL-HPA028251)
Citations for Anti FGFR4 pAb (ATL-HPA028251) – 1 Found
Soady, Kelly J; Tornillo, Giusy; Kendrick, Howard; Meniel, Valerie; Olijnyk-Dallis, Daria; Morris, Joanna S; Stein, Torsten; Gusterson, Barry A; Isacke, Clare M; Smalley, Matthew J. The receptor protein tyrosine phosphatase PTPRB negatively regulates FGF2-dependent branching morphogenesis. Development (Cambridge, England). 2017;144(20):3777-3788.  PubMed