Anti FGFR2 pAb (ATL-HPA035305)

Atlas Antibodies

Catalog No.: ATL-HPA035305-25

Protein Description: fibroblast growth factor receptor 2
Gene Name: FGFR2
Alternative Gene Name: BEK, CD332, CEK3, CFD1, ECT1, JWS, K-SAM, KGFR, TK14, TK25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030849: 93%, ENSRNOG00000016374: 91%
Entrez Gene ID: 2263
Uniprot ID: P21802
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMV
• Gene Sequence: PPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMV
• Gene ID - Mouse: ENSMUSG00000030849
• Gene ID - Rat: ENSRNOG00000016374
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FGFR2 pAb (ATL-HPA035305) – 1 Found

Tchaicha, Jeremy H; Akbay, Esra A; Altabef, Abigail; Mikse, Oliver R; Kikuchi, Eiki; Rhee, Kevin; Liao, Rachel G; Bronson, Roderick T; Sholl, Lynette M; Meyerson, Matthew; Hammerman, Peter S; Wong, Kwok-Kin. Kinase domain activation of FGFR2 yields high-grade lung adenocarcinoma sensitive to a Pan-FGFR inhibitor in a mouse model of NSCLC. Cancer Research. 2014;74(17):4676-84.