Anti FGFR1OP pAb (ATL-HPA071876)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071876-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FGFR1OP
Alternative Gene Name: FOP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069135: 84%, ENSRNOG00000055093: 84%
Entrez Gene ID: 11116
Uniprot ID: O95684
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVL |
| Gene Sequence | GDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVL |
| Gene ID - Mouse | ENSMUSG00000069135 |
| Gene ID - Rat | ENSRNOG00000055093 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FGFR1OP pAb (ATL-HPA071876) | |
| Datasheet | Anti FGFR1OP pAb (ATL-HPA071876) Datasheet (External Link) |
| Vendor Page | Anti FGFR1OP pAb (ATL-HPA071876) at Atlas Antibodies |
| Documents & Links for Anti FGFR1OP pAb (ATL-HPA071876) | |
| Datasheet | Anti FGFR1OP pAb (ATL-HPA071876) Datasheet (External Link) |
| Vendor Page | Anti FGFR1OP pAb (ATL-HPA071876) |
| Citations for Anti FGFR1OP pAb (ATL-HPA071876) – 1 Found |
| Steib, Emmanuelle; Laporte, Marine H; Gambarotto, Davide; Olieric, Natacha; Zheng, Celine; Borgers, Susanne; Olieric, Vincent; Le Guennec, Maeva; Koll, France; Tassin, Anne-Marie; Steinmetz, Michel O; Guichard, Paul; Hamel, Virginie. WDR90 is a centriolar microtubule wall protein important for centriole architecture integrity. Elife. 2020;9( 32946374) PubMed |