Anti FGFR1OP pAb (ATL-HPA071876)

Atlas Antibodies

Catalog No.: ATL-HPA071876-25

Protein Description: FGFR1 oncogene partner
Gene Name: FGFR1OP
Alternative Gene Name: FOP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069135: 84%, ENSRNOG00000055093: 84%
Entrez Gene ID: 11116
Uniprot ID: O95684
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVL
• Gene Sequence: GDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVL
• Gene ID - Mouse: ENSMUSG00000069135
• Gene ID - Rat: ENSRNOG00000055093
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FGFR1OP pAb (ATL-HPA071876) – 1 Found

Steib, Emmanuelle; Laporte, Marine H; Gambarotto, Davide; Olieric, Natacha; Zheng, Celine; Borgers, Susanne; Olieric, Vincent; Le Guennec, Maeva; Koll, France; Tassin, Anne-Marie; Steinmetz, Michel O; Guichard, Paul; Hamel, Virginie. WDR90 is a centriolar microtubule wall protein important for centriole architecture integrity. Elife. 2020;9( 32946374)