Anti FGFBP3 pAb (ATL-HPA053943)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053943-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FGFBP3
Alternative Gene Name: C10orf13, MGC39320
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047632: 59%, ENSRNOG00000022796: 63%
Entrez Gene ID: 143282
Uniprot ID: Q8TAT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AASNVAEPVPGPTGGSSGRFLSPEQHACSWQL |
| Gene Sequence | AASNVAEPVPGPTGGSSGRFLSPEQHACSWQL |
| Gene ID - Mouse | ENSMUSG00000047632 |
| Gene ID - Rat | ENSRNOG00000022796 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FGFBP3 pAb (ATL-HPA053943) | |
| Datasheet | Anti FGFBP3 pAb (ATL-HPA053943) Datasheet (External Link) |
| Vendor Page | Anti FGFBP3 pAb (ATL-HPA053943) at Atlas Antibodies |
| Documents & Links for Anti FGFBP3 pAb (ATL-HPA053943) | |
| Datasheet | Anti FGFBP3 pAb (ATL-HPA053943) Datasheet (External Link) |
| Vendor Page | Anti FGFBP3 pAb (ATL-HPA053943) |