Anti FGFBP3 pAb (ATL-HPA053943)

Atlas Antibodies

Catalog No.:
ATL-HPA053943-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: fibroblast growth factor binding protein 3
Gene Name: FGFBP3
Alternative Gene Name: C10orf13, MGC39320
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047632: 59%, ENSRNOG00000022796: 63%
Entrez Gene ID: 143282
Uniprot ID: Q8TAT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AASNVAEPVPGPTGGSSGRFLSPEQHACSWQL
Gene Sequence AASNVAEPVPGPTGGSSGRFLSPEQHACSWQL
Gene ID - Mouse ENSMUSG00000047632
Gene ID - Rat ENSRNOG00000022796
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FGFBP3 pAb (ATL-HPA053943)
Datasheet Anti FGFBP3 pAb (ATL-HPA053943) Datasheet (External Link)
Vendor Page Anti FGFBP3 pAb (ATL-HPA053943) at Atlas Antibodies

Documents & Links for Anti FGFBP3 pAb (ATL-HPA053943)
Datasheet Anti FGFBP3 pAb (ATL-HPA053943) Datasheet (External Link)
Vendor Page Anti FGFBP3 pAb (ATL-HPA053943)