Anti FGFBP2 pAb (ATL-HPA039180 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA039180-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: fibroblast growth factor binding protein 2
Gene Name: FGFBP2
Alternative Gene Name: KSP37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033088: 31%, ENSRNOG00000055226: 30%
Entrez Gene ID: 83888
Uniprot ID: Q9BYJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTR
Gene Sequence PVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTR
Gene ID - Mouse ENSMUSG00000033088
Gene ID - Rat ENSRNOG00000055226
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FGFBP2 pAb (ATL-HPA039180 w/enhanced validation)
Datasheet Anti FGFBP2 pAb (ATL-HPA039180 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FGFBP2 pAb (ATL-HPA039180 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FGFBP2 pAb (ATL-HPA039180 w/enhanced validation)
Datasheet Anti FGFBP2 pAb (ATL-HPA039180 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FGFBP2 pAb (ATL-HPA039180 w/enhanced validation)