Anti FGF5 pAb (ATL-HPA042442)

Atlas Antibodies

Catalog No.:
ATL-HPA042442-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: fibroblast growth factor 5
Gene Name: FGF5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029337: 86%, ENSRNOG00000022631: 88%
Entrez Gene ID: 2250
Uniprot ID: P12034
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG
Gene Sequence ALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG
Gene ID - Mouse ENSMUSG00000029337
Gene ID - Rat ENSRNOG00000022631
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FGF5 pAb (ATL-HPA042442)
Datasheet Anti FGF5 pAb (ATL-HPA042442) Datasheet (External Link)
Vendor Page Anti FGF5 pAb (ATL-HPA042442) at Atlas Antibodies

Documents & Links for Anti FGF5 pAb (ATL-HPA042442)
Datasheet Anti FGF5 pAb (ATL-HPA042442) Datasheet (External Link)
Vendor Page Anti FGF5 pAb (ATL-HPA042442)