Anti FGF4 pAb (ATL-HPA011209 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA011209-25

• 
• 

Protein Description: fibroblast growth factor 4
Gene Name: FGF4
Alternative Gene Name: HBGF-4, HST, HST-1, HSTF1, K-FGF, KFGF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050917: 91%, ENSRNOG00000020890: 91%
Entrez Gene ID: 2249
Uniprot ID: P08620
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL
• Gene Sequence: VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL
• Gene ID - Mouse: ENSMUSG00000050917
• Gene ID - Rat: ENSRNOG00000020890
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.