Anti FGF4 pAb (ATL-HPA011209 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011209-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FGF4
Alternative Gene Name: HBGF-4, HST, HST-1, HSTF1, K-FGF, KFGF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050917: 91%, ENSRNOG00000020890: 91%
Entrez Gene ID: 2249
Uniprot ID: P08620
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL |
| Gene Sequence | VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL |
| Gene ID - Mouse | ENSMUSG00000050917 |
| Gene ID - Rat | ENSRNOG00000020890 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FGF4 pAb (ATL-HPA011209 w/enhanced validation) | |
| Datasheet | Anti FGF4 pAb (ATL-HPA011209 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FGF4 pAb (ATL-HPA011209 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FGF4 pAb (ATL-HPA011209 w/enhanced validation) | |
| Datasheet | Anti FGF4 pAb (ATL-HPA011209 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FGF4 pAb (ATL-HPA011209 w/enhanced validation) |