Anti FGF2 pAb (ATL-HPA065502)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065502-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: FGF2
Alternative Gene Name: FGFB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037225: 97%, ENSRNOG00000017392: 97%
Entrez Gene ID: 2247
Uniprot ID: P09038
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKL |
Gene Sequence | KGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKL |
Gene ID - Mouse | ENSMUSG00000037225 |
Gene ID - Rat | ENSRNOG00000017392 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FGF2 pAb (ATL-HPA065502) | |
Datasheet | Anti FGF2 pAb (ATL-HPA065502) Datasheet (External Link) |
Vendor Page | Anti FGF2 pAb (ATL-HPA065502) at Atlas Antibodies |
Documents & Links for Anti FGF2 pAb (ATL-HPA065502) | |
Datasheet | Anti FGF2 pAb (ATL-HPA065502) Datasheet (External Link) |
Vendor Page | Anti FGF2 pAb (ATL-HPA065502) |