Anti FGF2 pAb (ATL-HPA065502)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065502-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: FGF2
Alternative Gene Name: FGFB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037225: 97%, ENSRNOG00000017392: 97%
Entrez Gene ID: 2247
Uniprot ID: P09038
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKL |
| Gene Sequence | KGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKL |
| Gene ID - Mouse | ENSMUSG00000037225 |
| Gene ID - Rat | ENSRNOG00000017392 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FGF2 pAb (ATL-HPA065502) | |
| Datasheet | Anti FGF2 pAb (ATL-HPA065502) Datasheet (External Link) |
| Vendor Page | Anti FGF2 pAb (ATL-HPA065502) at Atlas Antibodies |
| Documents & Links for Anti FGF2 pAb (ATL-HPA065502) | |
| Datasheet | Anti FGF2 pAb (ATL-HPA065502) Datasheet (External Link) |
| Vendor Page | Anti FGF2 pAb (ATL-HPA065502) |