Anti FGF12 pAb (ATL-HPA071557)

Atlas Antibodies

Catalog No.: ATL-HPA071557-25

Protein Description: fibroblast growth factor 12
Gene Name: FGF12
Alternative Gene Name: FGF12B, FHF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022523: 100%, ENSRNOG00000001931: 100%
Entrez Gene ID: 2257
Uniprot ID: P61328
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDS
• Gene Sequence: EPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDS
• Gene ID - Mouse: ENSMUSG00000022523
• Gene ID - Rat: ENSRNOG00000001931
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.