Anti FGF12 pAb (ATL-HPA071557)

Atlas Antibodies

Catalog No.:
ATL-HPA071557-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: fibroblast growth factor 12
Gene Name: FGF12
Alternative Gene Name: FGF12B, FHF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022523: 100%, ENSRNOG00000001931: 100%
Entrez Gene ID: 2257
Uniprot ID: P61328
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDS
Gene Sequence EPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDS
Gene ID - Mouse ENSMUSG00000022523
Gene ID - Rat ENSRNOG00000001931
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FGF12 pAb (ATL-HPA071557)
Datasheet Anti FGF12 pAb (ATL-HPA071557) Datasheet (External Link)
Vendor Page Anti FGF12 pAb (ATL-HPA071557) at Atlas Antibodies

Documents & Links for Anti FGF12 pAb (ATL-HPA071557)
Datasheet Anti FGF12 pAb (ATL-HPA071557) Datasheet (External Link)
Vendor Page Anti FGF12 pAb (ATL-HPA071557)