Anti FGD3 pAb (ATL-HPA021018)

Atlas Antibodies

SKU:
ATL-HPA021018-25
  • Immunohistochemical staining of human bone marrow shows strong positivity in a subset of hematopoietic cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FYVE, RhoGEF and PH domain containing 3
Gene Name: FGD3
Alternative Gene Name: FLJ00004, ZFYVE5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037946: 73%, ENSRNOG00000016225: 72%
Entrez Gene ID: 89846
Uniprot ID: Q5JSP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEEKKEWIQIIQATIEKHKQNSETFKAFGGAFSQDEDPSLSPDMPITSTSPVEPVVTTEGSSGAAGLEPRKLSSKTRRDKEKQSCKSCGETFNSITKRRHHCKLC
Gene Sequence EEEKKEWIQIIQATIEKHKQNSETFKAFGGAFSQDEDPSLSPDMPITSTSPVEPVVTTEGSSGAAGLEPRKLSSKTRRDKEKQSCKSCGETFNSITKRRHHCKLC
Gene ID - Mouse ENSMUSG00000037946
Gene ID - Rat ENSRNOG00000016225
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FGD3 pAb (ATL-HPA021018)
Datasheet Anti FGD3 pAb (ATL-HPA021018) Datasheet (External Link)
Vendor Page Anti FGD3 pAb (ATL-HPA021018) at Atlas Antibodies

Documents & Links for Anti FGD3 pAb (ATL-HPA021018)
Datasheet Anti FGD3 pAb (ATL-HPA021018) Datasheet (External Link)
Vendor Page Anti FGD3 pAb (ATL-HPA021018)