Anti FGD3 pAb (ATL-HPA020963)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020963-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FGD3
Alternative Gene Name: FLJ00004, ZFYVE5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037946: 62%, ENSRNOG00000016225: 58%
Entrez Gene ID: 89846
Uniprot ID: Q5JSP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PPGPIAALGMPDTGPGSSSLGKLQALPVGPRAHCGDPVSLAAAGDGSPDIGPTGELSGSLKIPNRDSGIDSPSSSVAGE |
| Gene Sequence | PPGPIAALGMPDTGPGSSSLGKLQALPVGPRAHCGDPVSLAAAGDGSPDIGPTGELSGSLKIPNRDSGIDSPSSSVAGE |
| Gene ID - Mouse | ENSMUSG00000037946 |
| Gene ID - Rat | ENSRNOG00000016225 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FGD3 pAb (ATL-HPA020963) | |
| Datasheet | Anti FGD3 pAb (ATL-HPA020963) Datasheet (External Link) |
| Vendor Page | Anti FGD3 pAb (ATL-HPA020963) at Atlas Antibodies |
| Documents & Links for Anti FGD3 pAb (ATL-HPA020963) | |
| Datasheet | Anti FGD3 pAb (ATL-HPA020963) Datasheet (External Link) |
| Vendor Page | Anti FGD3 pAb (ATL-HPA020963) |
| Citations for Anti FGD3 pAb (ATL-HPA020963) – 1 Found |
| Susini, Tommaso; Saccardin, Giulia; Renda, Irene; Giani, Milo; Tartarotti, Enrico; Nori, Jacopo; Vanzi, Ermanno; Pasqualini, Elisa; Bianchi, Simonetta. Immunohistochemical Evaluation of FGD3 Expression: A New Strong Prognostic Factor in Invasive Breast Cancer. Cancers. 2021;13(15) PubMed |