Anti FGD3 pAb (ATL-HPA020963)

Atlas Antibodies

SKU: ATL-HPA020963-25

• 

Protein Description: FYVE, RhoGEF and PH domain containing 3
Gene Name: FGD3
Alternative Gene Name: FLJ00004, ZFYVE5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037946: 62%, ENSRNOG00000016225: 58%
Entrez Gene ID: 89846
Uniprot ID: Q5JSP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPGPIAALGMPDTGPGSSSLGKLQALPVGPRAHCGDPVSLAAAGDGSPDIGPTGELSGSLKIPNRDSGIDSPSSSVAGE
• Gene Sequence: PPGPIAALGMPDTGPGSSSLGKLQALPVGPRAHCGDPVSLAAAGDGSPDIGPTGELSGSLKIPNRDSGIDSPSSSVAGE
• Gene ID - Mouse: ENSMUSG00000037946
• Gene ID - Rat: ENSRNOG00000016225
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FGD3 pAb (ATL-HPA020963) – 1 Found

Susini, Tommaso; Saccardin, Giulia; Renda, Irene; Giani, Milo; Tartarotti, Enrico; Nori, Jacopo; Vanzi, Ermanno; Pasqualini, Elisa; Bianchi, Simonetta. Immunohistochemical Evaluation of FGD3 Expression: A New Strong Prognostic Factor in Invasive Breast Cancer. Cancers. 2021;13(15)