Anti FGB pAb (ATL-HPA001900 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001900-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FGB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033831: 74%, ENSRNOG00000007092: 73%
Entrez Gene ID: 2244
Uniprot ID: P02675
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQERPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLE |
| Gene Sequence | ERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQERPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLE |
| Gene ID - Mouse | ENSMUSG00000033831 |
| Gene ID - Rat | ENSRNOG00000007092 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FGB pAb (ATL-HPA001900 w/enhanced validation) | |
| Datasheet | Anti FGB pAb (ATL-HPA001900 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FGB pAb (ATL-HPA001900 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FGB pAb (ATL-HPA001900 w/enhanced validation) | |
| Datasheet | Anti FGB pAb (ATL-HPA001900 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FGB pAb (ATL-HPA001900 w/enhanced validation) |
| Citations for Anti FGB pAb (ATL-HPA001900 w/enhanced validation) – 7 Found |
| Gonzalez, Rachel M; Zhang, Qibin; Zangar, Richard C; Smith, Richard D; Metz, Thomas O. Development of a fibrinogen-specific sandwich enzyme-linked immunosorbent assay microarray assay for distinguishing between blood plasma and serum samples. Analytical Biochemistry. 2011;414(1):99-102. PubMed |
| Karthikeyan, Kailash; Barker, Kristi; Tang, Yanyang; Kahn, Peter; Wiktor, Peter; Brunner, Al; Knabben, Vinicius; Takulapalli, Bharath; Buckner, Jane; Nepom, Gerald; LaBaer, Joshua; Qiu, Ji. A Contra Capture Protein Array Platform for Studying Post-translationally Modified (PTM) Auto-antigenomes. Molecular & Cellular Proteomics : Mcp. 2016;15(7):2324-37. PubMed |
| Häggmark, Anna; Neiman, Maja; Drobin, Kimi; Zwahlen, Martin; Uhlén, Mathias; Nilsson, Peter; Schwenk, Jochen M. Classification of protein profiles from antibody microarrays using heat and detergent treatment. New Biotechnology. 2012;29(5):564-70. PubMed |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
| Lindén, Mårten; Segersten, Ulrika; Runeson, Marcus; Wester, Kenneth; Busch, Christer; Pettersson, Ulf; Lind, Sara Bergström; Malmström, Per-Uno. Tumour expression of bladder cancer-associated urinary proteins. Bju International. 2013;112(3):407-15. PubMed |
| Qundos, Ulrika; Hong, Mun-Gwan; Tybring, Gunnel; Divers, Mark; Odeberg, Jacob; Uhlen, Mathias; Nilsson, Peter; Schwenk, Jochen M. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. Journal Of Proteomics. 2013;95( 23631827):46-54. PubMed |
| Becatti, Matteo; Mannucci, Amanda; Argento, Flavia Rita; Gitto, Stefano; Vizzutti, Francesco; Marra, Fabio; Taddei, Niccolò; Fiorillo, Claudia; Laffi, Giacomo. Super-Resolution Microscopy Reveals an Altered Fibrin Network in Cirrhosis: The Key Role of Oxidative Stress in Fibrinogen Structural Modifications. Antioxidants (Basel, Switzerland). 2020;9(8) PubMed |