Anti FEZF1 pAb (ATL-HPA073693)

Atlas Antibodies

Catalog No.:
ATL-HPA073693-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: FEZ family zinc finger 1
Gene Name: FEZF1
Alternative Gene Name: ZNF312B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029697: 98%, ENSRNOG00000007608: 95%
Entrez Gene ID: 389549
Uniprot ID: A0PJY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEKIAFKTSDFSRGSPNAKPKV
Gene Sequence YLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEKIAFKTSDFSRGSPNAKPKV
Gene ID - Mouse ENSMUSG00000029697
Gene ID - Rat ENSRNOG00000007608
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FEZF1 pAb (ATL-HPA073693)
Datasheet Anti FEZF1 pAb (ATL-HPA073693) Datasheet (External Link)
Vendor Page Anti FEZF1 pAb (ATL-HPA073693) at Atlas Antibodies

Documents & Links for Anti FEZF1 pAb (ATL-HPA073693)
Datasheet Anti FEZF1 pAb (ATL-HPA073693) Datasheet (External Link)
Vendor Page Anti FEZF1 pAb (ATL-HPA073693)