Anti FEZF1 pAb (ATL-HPA073693)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073693-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FEZF1
Alternative Gene Name: ZNF312B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029697: 98%, ENSRNOG00000007608: 95%
Entrez Gene ID: 389549
Uniprot ID: A0PJY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEKIAFKTSDFSRGSPNAKPKV |
| Gene Sequence | YLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEKIAFKTSDFSRGSPNAKPKV |
| Gene ID - Mouse | ENSMUSG00000029697 |
| Gene ID - Rat | ENSRNOG00000007608 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FEZF1 pAb (ATL-HPA073693) | |
| Datasheet | Anti FEZF1 pAb (ATL-HPA073693) Datasheet (External Link) |
| Vendor Page | Anti FEZF1 pAb (ATL-HPA073693) at Atlas Antibodies |
| Documents & Links for Anti FEZF1 pAb (ATL-HPA073693) | |
| Datasheet | Anti FEZF1 pAb (ATL-HPA073693) Datasheet (External Link) |
| Vendor Page | Anti FEZF1 pAb (ATL-HPA073693) |