Anti FEZ2 pAb (ATL-HPA035978)

Atlas Antibodies

SKU:
ATL-HPA035978-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic and nucleolar positivity in cells in tubules.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli, cytosol & the Golgi apparatus.
  • Western blot analysis in human cell line U-251 MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: fasciculation and elongation protein zeta 2 (zygin II)
Gene Name: FEZ2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056121: 92%, ENSRNOG00000004577: 95%
Entrez Gene ID: 9637
Uniprot ID: Q9UHY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSYEERVKRLSVSELNEILEEIETAIKEYSEELVQQLALRDELEFEKEVKNSFISVLIEVQNKQKEHKETAKKKKKLKNGSSQNGKNERSHMPGTYLTTVIPYEKKNGPPSVEDLQILTKILRAMKEDSEKVPSLLTDYIL
Gene Sequence GSYEERVKRLSVSELNEILEEIETAIKEYSEELVQQLALRDELEFEKEVKNSFISVLIEVQNKQKEHKETAKKKKKLKNGSSQNGKNERSHMPGTYLTTVIPYEKKNGPPSVEDLQILTKILRAMKEDSEKVPSLLTDYIL
Gene ID - Mouse ENSMUSG00000056121
Gene ID - Rat ENSRNOG00000004577
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FEZ2 pAb (ATL-HPA035978)
Datasheet Anti FEZ2 pAb (ATL-HPA035978) Datasheet (External Link)
Vendor Page Anti FEZ2 pAb (ATL-HPA035978) at Atlas Antibodies

Documents & Links for Anti FEZ2 pAb (ATL-HPA035978)
Datasheet Anti FEZ2 pAb (ATL-HPA035978) Datasheet (External Link)
Vendor Page Anti FEZ2 pAb (ATL-HPA035978)