Anti FEZ1 pAb (ATL-HPA076844)

Atlas Antibodies

Catalog No.:
ATL-HPA076844-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: fasciculation and elongation protein zeta 1
Gene Name: FEZ1
Alternative Gene Name: UNC-76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032118: 98%, ENSRNOG00000006075: 96%
Entrez Gene ID: 9638
Uniprot ID: Q99689
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTE
Gene Sequence EEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTE
Gene ID - Mouse ENSMUSG00000032118
Gene ID - Rat ENSRNOG00000006075
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FEZ1 pAb (ATL-HPA076844)
Datasheet Anti FEZ1 pAb (ATL-HPA076844) Datasheet (External Link)
Vendor Page Anti FEZ1 pAb (ATL-HPA076844) at Atlas Antibodies

Documents & Links for Anti FEZ1 pAb (ATL-HPA076844)
Datasheet Anti FEZ1 pAb (ATL-HPA076844) Datasheet (External Link)
Vendor Page Anti FEZ1 pAb (ATL-HPA076844)