Anti FERMT2 pAb (ATL-HPA072965)

Atlas Antibodies

Catalog No.:
ATL-HPA072965-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: fermitin family member 2
Gene Name: FERMT2
Alternative Gene Name: KIND2, mig-2, PLEKHC1, UNC112B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037712: 98%, ENSRNOG00000009102: 98%
Entrez Gene ID: 10979
Uniprot ID: Q96AC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQALLDK
Gene Sequence YDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQALLDK
Gene ID - Mouse ENSMUSG00000037712
Gene ID - Rat ENSRNOG00000009102
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FERMT2 pAb (ATL-HPA072965)
Datasheet Anti FERMT2 pAb (ATL-HPA072965) Datasheet (External Link)
Vendor Page Anti FERMT2 pAb (ATL-HPA072965) at Atlas Antibodies

Documents & Links for Anti FERMT2 pAb (ATL-HPA072965)
Datasheet Anti FERMT2 pAb (ATL-HPA072965) Datasheet (External Link)
Vendor Page Anti FERMT2 pAb (ATL-HPA072965)