Anti FEM1C pAb (ATL-HPA060977)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060977-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FEM1C
Alternative Gene Name: EUROIMAGE686608, EUROIMAGE783647, FEM1A, KIAA1785
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033319: 99%, ENSRNOG00000003578: 100%
Entrez Gene ID: 56929
Uniprot ID: Q96JP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SFMLQDRAKGLLGTTVTFDDLMGILCKSVLEIERAIKQTQCPADPLQLNKALSIILHLICLLEKVPCTLEQDHFKKQTIYRFLKLHP |
| Gene Sequence | SFMLQDRAKGLLGTTVTFDDLMGILCKSVLEIERAIKQTQCPADPLQLNKALSIILHLICLLEKVPCTLEQDHFKKQTIYRFLKLHP |
| Gene ID - Mouse | ENSMUSG00000033319 |
| Gene ID - Rat | ENSRNOG00000003578 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FEM1C pAb (ATL-HPA060977) | |
| Datasheet | Anti FEM1C pAb (ATL-HPA060977) Datasheet (External Link) |
| Vendor Page | Anti FEM1C pAb (ATL-HPA060977) at Atlas Antibodies |
| Documents & Links for Anti FEM1C pAb (ATL-HPA060977) | |
| Datasheet | Anti FEM1C pAb (ATL-HPA060977) Datasheet (External Link) |
| Vendor Page | Anti FEM1C pAb (ATL-HPA060977) |