Anti FECH pAb (ATL-HPA048177)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048177-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FECH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024588: 89%, ENSRNOG00000018053: 89%
Entrez Gene ID: 2235
Uniprot ID: P22830
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | THHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGL |
| Gene Sequence | THHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGL |
| Gene ID - Mouse | ENSMUSG00000024588 |
| Gene ID - Rat | ENSRNOG00000018053 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FECH pAb (ATL-HPA048177) | |
| Datasheet | Anti FECH pAb (ATL-HPA048177) Datasheet (External Link) |
| Vendor Page | Anti FECH pAb (ATL-HPA048177) at Atlas Antibodies |
| Documents & Links for Anti FECH pAb (ATL-HPA048177) | |
| Datasheet | Anti FECH pAb (ATL-HPA048177) Datasheet (External Link) |
| Vendor Page | Anti FECH pAb (ATL-HPA048177) |