Anti FECH pAb (ATL-HPA044100)

Atlas Antibodies

Catalog No.:
ATL-HPA044100-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ferrochelatase
Gene Name: FECH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024588: 91%, ENSRNOG00000018053: 92%
Entrez Gene ID: 2235
Uniprot ID: P22830
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQ
Gene Sequence ILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQ
Gene ID - Mouse ENSMUSG00000024588
Gene ID - Rat ENSRNOG00000018053
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FECH pAb (ATL-HPA044100)
Datasheet Anti FECH pAb (ATL-HPA044100) Datasheet (External Link)
Vendor Page Anti FECH pAb (ATL-HPA044100) at Atlas Antibodies

Documents & Links for Anti FECH pAb (ATL-HPA044100)
Datasheet Anti FECH pAb (ATL-HPA044100) Datasheet (External Link)
Vendor Page Anti FECH pAb (ATL-HPA044100)