Anti FECH pAb (ATL-HPA044100)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044100-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FECH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024588: 91%, ENSRNOG00000018053: 92%
Entrez Gene ID: 2235
Uniprot ID: P22830
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQ |
Gene Sequence | ILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQ |
Gene ID - Mouse | ENSMUSG00000024588 |
Gene ID - Rat | ENSRNOG00000018053 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FECH pAb (ATL-HPA044100) | |
Datasheet | Anti FECH pAb (ATL-HPA044100) Datasheet (External Link) |
Vendor Page | Anti FECH pAb (ATL-HPA044100) at Atlas Antibodies |
Documents & Links for Anti FECH pAb (ATL-HPA044100) | |
Datasheet | Anti FECH pAb (ATL-HPA044100) Datasheet (External Link) |
Vendor Page | Anti FECH pAb (ATL-HPA044100) |