Anti FDPS pAb (ATL-HPA028200)

Atlas Antibodies

Catalog No.:
ATL-HPA028200-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: farnesyl diphosphate synthase
Gene Name: FDPS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059743: 78%, ENSRNOG00000043377: 76%
Entrez Gene ID: 2224
Uniprot ID: P14324
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLVHGYPVLAWHSARCWCQAWTEEPRALCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYN
Gene Sequence SLVHGYPVLAWHSARCWCQAWTEEPRALCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYN
Gene ID - Mouse ENSMUSG00000059743
Gene ID - Rat ENSRNOG00000043377
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FDPS pAb (ATL-HPA028200)
Datasheet Anti FDPS pAb (ATL-HPA028200) Datasheet (External Link)
Vendor Page Anti FDPS pAb (ATL-HPA028200) at Atlas Antibodies

Documents & Links for Anti FDPS pAb (ATL-HPA028200)
Datasheet Anti FDPS pAb (ATL-HPA028200) Datasheet (External Link)
Vendor Page Anti FDPS pAb (ATL-HPA028200)
Citations for Anti FDPS pAb (ATL-HPA028200) – 1 Found
Griveau, Audrey; Wiel, Clotilde; Le Calvé, Benjamin; Ziegler, Dorian V; Djebali, Sophia; Warnier, Marine; Martin, Nadine; Marvel, Jacqueline; Vindrieux, David; Bergo, Martin O; Bernard, David. Targeting the phospholipase A2 receptor ameliorates premature aging phenotypes. Aging Cell. 2018;17(6):e12835.  PubMed