Anti FDPS pAb (ATL-HPA028200)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028200-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FDPS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059743: 78%, ENSRNOG00000043377: 76%
Entrez Gene ID: 2224
Uniprot ID: P14324
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLVHGYPVLAWHSARCWCQAWTEEPRALCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYN |
Gene Sequence | SLVHGYPVLAWHSARCWCQAWTEEPRALCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYN |
Gene ID - Mouse | ENSMUSG00000059743 |
Gene ID - Rat | ENSRNOG00000043377 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FDPS pAb (ATL-HPA028200) | |
Datasheet | Anti FDPS pAb (ATL-HPA028200) Datasheet (External Link) |
Vendor Page | Anti FDPS pAb (ATL-HPA028200) at Atlas Antibodies |
Documents & Links for Anti FDPS pAb (ATL-HPA028200) | |
Datasheet | Anti FDPS pAb (ATL-HPA028200) Datasheet (External Link) |
Vendor Page | Anti FDPS pAb (ATL-HPA028200) |
Citations for Anti FDPS pAb (ATL-HPA028200) – 1 Found |
Griveau, Audrey; Wiel, Clotilde; Le Calvé, Benjamin; Ziegler, Dorian V; Djebali, Sophia; Warnier, Marine; Martin, Nadine; Marvel, Jacqueline; Vindrieux, David; Bergo, Martin O; Bernard, David. Targeting the phospholipase A2 receptor ameliorates premature aging phenotypes. Aging Cell. 2018;17(6):e12835. PubMed |