Anti FDPS pAb (ATL-HPA028200)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028200-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FDPS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059743: 78%, ENSRNOG00000043377: 76%
Entrez Gene ID: 2224
Uniprot ID: P14324
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLVHGYPVLAWHSARCWCQAWTEEPRALCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYN |
| Gene Sequence | SLVHGYPVLAWHSARCWCQAWTEEPRALCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYN |
| Gene ID - Mouse | ENSMUSG00000059743 |
| Gene ID - Rat | ENSRNOG00000043377 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FDPS pAb (ATL-HPA028200) | |
| Datasheet | Anti FDPS pAb (ATL-HPA028200) Datasheet (External Link) |
| Vendor Page | Anti FDPS pAb (ATL-HPA028200) at Atlas Antibodies |
| Documents & Links for Anti FDPS pAb (ATL-HPA028200) | |
| Datasheet | Anti FDPS pAb (ATL-HPA028200) Datasheet (External Link) |
| Vendor Page | Anti FDPS pAb (ATL-HPA028200) |
| Citations for Anti FDPS pAb (ATL-HPA028200) – 1 Found |
| Griveau, Audrey; Wiel, Clotilde; Le Calvé, Benjamin; Ziegler, Dorian V; Djebali, Sophia; Warnier, Marine; Martin, Nadine; Marvel, Jacqueline; Vindrieux, David; Bergo, Martin O; Bernard, David. Targeting the phospholipase A2 receptor ameliorates premature aging phenotypes. Aging Cell. 2018;17(6):e12835. PubMed |