Anti FDCSP pAb (ATL-HPA014326 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA014326-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FDCSP
Alternative Gene Name: C4orf7, FDC-SP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014907: 33%, ENSRNOG00000007302: 37%
Entrez Gene ID: 260436
Uniprot ID: Q8NFU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPL |
Gene Sequence | KRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPL |
Gene ID - Mouse | ENSMUSG00000014907 |
Gene ID - Rat | ENSRNOG00000007302 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FDCSP pAb (ATL-HPA014326 w/enhanced validation) | |
Datasheet | Anti FDCSP pAb (ATL-HPA014326 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FDCSP pAb (ATL-HPA014326 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti FDCSP pAb (ATL-HPA014326 w/enhanced validation) | |
Datasheet | Anti FDCSP pAb (ATL-HPA014326 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FDCSP pAb (ATL-HPA014326 w/enhanced validation) |
Citations for Anti FDCSP pAb (ATL-HPA014326 w/enhanced validation) – 1 Found |
Dabija-Wolter, G; Bakken, V; Cimpan, M R; Johannessen, A C; Costea, D E. In vitro reconstruction of human junctional and sulcular epithelium. Journal Of Oral Pathology & Medicine : Official Publication Of The International Association Of Oral Pathologists And The American Academy Of Oral Pathology. 2013;42(5):396-404. PubMed |