Anti FCHO2 pAb (ATL-HPA077850)

Atlas Antibodies

Catalog No.:
ATL-HPA077850-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: FCH domain only 2
Gene Name: FCHO2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041685: 87%, ENSRNOG00000015334: 87%
Entrez Gene ID: 115548
Uniprot ID: Q0JRZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KVSIGNITLSPAISRHSPVQMNRNLSNEELTKSKPSAPPNEKGTSDLLAWDPLFGPSLDSSS
Gene Sequence KVSIGNITLSPAISRHSPVQMNRNLSNEELTKSKPSAPPNEKGTSDLLAWDPLFGPSLDSSS
Gene ID - Mouse ENSMUSG00000041685
Gene ID - Rat ENSRNOG00000015334
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FCHO2 pAb (ATL-HPA077850)
Datasheet Anti FCHO2 pAb (ATL-HPA077850) Datasheet (External Link)
Vendor Page Anti FCHO2 pAb (ATL-HPA077850) at Atlas Antibodies

Documents & Links for Anti FCHO2 pAb (ATL-HPA077850)
Datasheet Anti FCHO2 pAb (ATL-HPA077850) Datasheet (External Link)
Vendor Page Anti FCHO2 pAb (ATL-HPA077850)