Anti FCER2 pAb (ATL-HPA067430 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA067430-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: Fc fragment of IgE receptor II
Gene Name: FCER2
Alternative Gene Name: CD23, CD23A, CLEC4J, FCE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005540: 56%, ENSRNOG00000001005: 59%
Entrez Gene ID: 2208
Uniprot ID: P06734
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGT
Gene Sequence LKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGT
Gene ID - Mouse ENSMUSG00000005540
Gene ID - Rat ENSRNOG00000001005
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FCER2 pAb (ATL-HPA067430 w/enhanced validation)
Datasheet Anti FCER2 pAb (ATL-HPA067430 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FCER2 pAb (ATL-HPA067430 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FCER2 pAb (ATL-HPA067430 w/enhanced validation)
Datasheet Anti FCER2 pAb (ATL-HPA067430 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FCER2 pAb (ATL-HPA067430 w/enhanced validation)