Anti FBXW2 pAb (ATL-HPA067878)

Atlas Antibodies

SKU:
ATL-HPA067878-25
  • Immunohistochemical staining of human duodenum shows strong granular cytoplasmic positivity in a subset of glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: F-box and WD repeat domain containing 2
Gene Name: FBXW2
Alternative Gene Name: FBW2, Fwd2, Md6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035949: 99%, ENSRNOG00000018687: 100%
Entrez Gene ID: 26190
Uniprot ID: Q9UKT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LYIMDLRTESLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSIHLVLWKEHG
Gene Sequence LYIMDLRTESLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSIHLVLWKEHG
Gene ID - Mouse ENSMUSG00000035949
Gene ID - Rat ENSRNOG00000018687
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FBXW2 pAb (ATL-HPA067878)
Datasheet Anti FBXW2 pAb (ATL-HPA067878) Datasheet (External Link)
Vendor Page Anti FBXW2 pAb (ATL-HPA067878) at Atlas Antibodies

Documents & Links for Anti FBXW2 pAb (ATL-HPA067878)
Datasheet Anti FBXW2 pAb (ATL-HPA067878) Datasheet (External Link)
Vendor Page Anti FBXW2 pAb (ATL-HPA067878)