Anti FBXO6 pAb (ATL-HPA051175)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051175-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FBXO6
Alternative Gene Name: FBG2, FBS2, FBX6, Fbx6b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021962: 32%, ENSRNOG00000023931: 33%
Entrez Gene ID: 26270
Uniprot ID: Q9NRD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQI |
Gene Sequence | RVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQI |
Gene ID - Mouse | ENSMUSG00000021962 |
Gene ID - Rat | ENSRNOG00000023931 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FBXO6 pAb (ATL-HPA051175) | |
Datasheet | Anti FBXO6 pAb (ATL-HPA051175) Datasheet (External Link) |
Vendor Page | Anti FBXO6 pAb (ATL-HPA051175) at Atlas Antibodies |
Documents & Links for Anti FBXO6 pAb (ATL-HPA051175) | |
Datasheet | Anti FBXO6 pAb (ATL-HPA051175) Datasheet (External Link) |
Vendor Page | Anti FBXO6 pAb (ATL-HPA051175) |