Anti FBXO48 pAb (ATL-HPA054782)

Atlas Antibodies

Catalog No.:
ATL-HPA054782-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: F-box protein 48
Gene Name: FBXO48
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044966: 84%, ENSRNOG00000023026: 80%
Entrez Gene ID: 554251
Uniprot ID: Q5FWF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLSGRYSN
Gene Sequence WNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLSGRYSN
Gene ID - Mouse ENSMUSG00000044966
Gene ID - Rat ENSRNOG00000023026
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FBXO48 pAb (ATL-HPA054782)
Datasheet Anti FBXO48 pAb (ATL-HPA054782) Datasheet (External Link)
Vendor Page Anti FBXO48 pAb (ATL-HPA054782) at Atlas Antibodies

Documents & Links for Anti FBXO48 pAb (ATL-HPA054782)
Datasheet Anti FBXO48 pAb (ATL-HPA054782) Datasheet (External Link)
Vendor Page Anti FBXO48 pAb (ATL-HPA054782)