Anti FBXO48 pAb (ATL-HPA049775)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049775-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FBXO48
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044966: 68%, ENSRNOG00000023026: 55%
Entrez Gene ID: 554251
Uniprot ID: Q5FWF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASL |
Gene Sequence | SKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASL |
Gene ID - Mouse | ENSMUSG00000044966 |
Gene ID - Rat | ENSRNOG00000023026 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FBXO48 pAb (ATL-HPA049775) | |
Datasheet | Anti FBXO48 pAb (ATL-HPA049775) Datasheet (External Link) |
Vendor Page | Anti FBXO48 pAb (ATL-HPA049775) at Atlas Antibodies |
Documents & Links for Anti FBXO48 pAb (ATL-HPA049775) | |
Datasheet | Anti FBXO48 pAb (ATL-HPA049775) Datasheet (External Link) |
Vendor Page | Anti FBXO48 pAb (ATL-HPA049775) |