Anti FBXO46 pAb (ATL-HPA049390)

Atlas Antibodies

Catalog No.:
ATL-HPA049390-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: F-box protein 46
Gene Name: FBXO46
Alternative Gene Name: 20D7-FC4, Fbx46, FBXO34L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050428: 95%, ENSRNOG00000008815: 96%
Entrez Gene ID: 23403
Uniprot ID: Q6PJ61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YPRPTTPAPVVFVSAEQGGPAKGVGSERRSGGGDCSRVAEAVAHFEAQRDSPPTKGLRKEERPGPGPGEVRIAFRISNG
Gene Sequence YPRPTTPAPVVFVSAEQGGPAKGVGSERRSGGGDCSRVAEAVAHFEAQRDSPPTKGLRKEERPGPGPGEVRIAFRISNG
Gene ID - Mouse ENSMUSG00000050428
Gene ID - Rat ENSRNOG00000008815
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FBXO46 pAb (ATL-HPA049390)
Datasheet Anti FBXO46 pAb (ATL-HPA049390) Datasheet (External Link)
Vendor Page Anti FBXO46 pAb (ATL-HPA049390) at Atlas Antibodies

Documents & Links for Anti FBXO46 pAb (ATL-HPA049390)
Datasheet Anti FBXO46 pAb (ATL-HPA049390) Datasheet (External Link)
Vendor Page Anti FBXO46 pAb (ATL-HPA049390)