Anti FBXO36 pAb (ATL-HPA053865)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053865-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FBXO36
Alternative Gene Name: Fbx36, FLJ37592
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073633: 76%, ENSRNOG00000017053: 80%
Entrez Gene ID: 130888
Uniprot ID: Q8NEA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGWRQLFFTNKLQLQRQLRKRKQ |
Gene Sequence | RLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGWRQLFFTNKLQLQRQLRKRKQ |
Gene ID - Mouse | ENSMUSG00000073633 |
Gene ID - Rat | ENSRNOG00000017053 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FBXO36 pAb (ATL-HPA053865) | |
Datasheet | Anti FBXO36 pAb (ATL-HPA053865) Datasheet (External Link) |
Vendor Page | Anti FBXO36 pAb (ATL-HPA053865) at Atlas Antibodies |
Documents & Links for Anti FBXO36 pAb (ATL-HPA053865) | |
Datasheet | Anti FBXO36 pAb (ATL-HPA053865) Datasheet (External Link) |
Vendor Page | Anti FBXO36 pAb (ATL-HPA053865) |