Anti FBXO16 pAb (ATL-HPA058676)

Atlas Antibodies

Catalog No.:
ATL-HPA058676-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: F-box protein 16
Gene Name: FBXO16
Alternative Gene Name: FBX16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034532: 99%, ENSRNOG00000014003: 99%
Entrez Gene ID: 157574
Uniprot ID: Q8IX29
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRV
Gene Sequence TPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRV
Gene ID - Mouse ENSMUSG00000034532
Gene ID - Rat ENSRNOG00000014003
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FBXO16 pAb (ATL-HPA058676)
Datasheet Anti FBXO16 pAb (ATL-HPA058676) Datasheet (External Link)
Vendor Page Anti FBXO16 pAb (ATL-HPA058676) at Atlas Antibodies

Documents & Links for Anti FBXO16 pAb (ATL-HPA058676)
Datasheet Anti FBXO16 pAb (ATL-HPA058676) Datasheet (External Link)
Vendor Page Anti FBXO16 pAb (ATL-HPA058676)