Anti FBXL7 pAb (ATL-HPA055464)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055464-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FBXL7
Alternative Gene Name: FBL6, FBL7, KIAA0840
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043556: 99%, ENSRNOG00000024433: 99%
Entrez Gene ID: 23194
Uniprot ID: Q9UJT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLC |
| Gene Sequence | LTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLC |
| Gene ID - Mouse | ENSMUSG00000043556 |
| Gene ID - Rat | ENSRNOG00000024433 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FBXL7 pAb (ATL-HPA055464) | |
| Datasheet | Anti FBXL7 pAb (ATL-HPA055464) Datasheet (External Link) |
| Vendor Page | Anti FBXL7 pAb (ATL-HPA055464) at Atlas Antibodies |
| Documents & Links for Anti FBXL7 pAb (ATL-HPA055464) | |
| Datasheet | Anti FBXL7 pAb (ATL-HPA055464) Datasheet (External Link) |
| Vendor Page | Anti FBXL7 pAb (ATL-HPA055464) |