Anti FBXL3 pAb (ATL-HPA053283)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053283-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FBXL3
Alternative Gene Name: FBL3, FBL3A, FBXL3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022124: 100%, ENSRNOG00000059334: 100%
Entrez Gene ID: 26224
Uniprot ID: Q9UKT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDELLLALSS |
| Gene Sequence | HFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDELLLALSS |
| Gene ID - Mouse | ENSMUSG00000022124 |
| Gene ID - Rat | ENSRNOG00000059334 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FBXL3 pAb (ATL-HPA053283) | |
| Datasheet | Anti FBXL3 pAb (ATL-HPA053283) Datasheet (External Link) |
| Vendor Page | Anti FBXL3 pAb (ATL-HPA053283) at Atlas Antibodies |
| Documents & Links for Anti FBXL3 pAb (ATL-HPA053283) | |
| Datasheet | Anti FBXL3 pAb (ATL-HPA053283) Datasheet (External Link) |
| Vendor Page | Anti FBXL3 pAb (ATL-HPA053283) |