Anti FBXL19 pAb (ATL-HPA074250)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074250-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FBXL19
Alternative Gene Name: CXXC11, DKFZp434K0410, Fbl19, JHDM1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030811: 96%, ENSRNOG00000018986: 96%
Entrez Gene ID: 54620
Uniprot ID: Q6PCT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GNEPPTPRKKVKGGRERHLKKVGGDACLLRGSDPGGPGLLPPRVLNPSQAFSSCHPGLPPENWEKPKPPLASAEGP |
| Gene Sequence | GNEPPTPRKKVKGGRERHLKKVGGDACLLRGSDPGGPGLLPPRVLNPSQAFSSCHPGLPPENWEKPKPPLASAEGP |
| Gene ID - Mouse | ENSMUSG00000030811 |
| Gene ID - Rat | ENSRNOG00000018986 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FBXL19 pAb (ATL-HPA074250) | |
| Datasheet | Anti FBXL19 pAb (ATL-HPA074250) Datasheet (External Link) |
| Vendor Page | Anti FBXL19 pAb (ATL-HPA074250) at Atlas Antibodies |
| Documents & Links for Anti FBXL19 pAb (ATL-HPA074250) | |
| Datasheet | Anti FBXL19 pAb (ATL-HPA074250) Datasheet (External Link) |
| Vendor Page | Anti FBXL19 pAb (ATL-HPA074250) |