Anti FBXL16 pAb (ATL-HPA056354 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA056354-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: F-box and leucine-rich repeat protein 16
Gene Name: FBXL16
Alternative Gene Name: C16orf22, Fbl16, MGC33974
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025738: 100%, ENSRNOG00000022248: 100%
Entrez Gene ID: 146330
Uniprot ID: Q8N461
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CPRITDMALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKH
Gene Sequence CPRITDMALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKH
Gene ID - Mouse ENSMUSG00000025738
Gene ID - Rat ENSRNOG00000022248
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FBXL16 pAb (ATL-HPA056354 w/enhanced validation)
Datasheet Anti FBXL16 pAb (ATL-HPA056354 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FBXL16 pAb (ATL-HPA056354 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FBXL16 pAb (ATL-HPA056354 w/enhanced validation)
Datasheet Anti FBXL16 pAb (ATL-HPA056354 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FBXL16 pAb (ATL-HPA056354 w/enhanced validation)