Anti FBXL13 pAb (ATL-HPA057232)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057232-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FBXL13
Alternative Gene Name: Fbl13, MGC21636
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048520: 74%, ENSRNOG00000043035: 67%
Entrez Gene ID: 222235
Uniprot ID: Q8NEE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GNKRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNLANCVRIGDMGLKQFLDGPASMRIRELNLSNCV |
Gene Sequence | GNKRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNLANCVRIGDMGLKQFLDGPASMRIRELNLSNCV |
Gene ID - Mouse | ENSMUSG00000048520 |
Gene ID - Rat | ENSRNOG00000043035 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FBXL13 pAb (ATL-HPA057232) | |
Datasheet | Anti FBXL13 pAb (ATL-HPA057232) Datasheet (External Link) |
Vendor Page | Anti FBXL13 pAb (ATL-HPA057232) at Atlas Antibodies |
Documents & Links for Anti FBXL13 pAb (ATL-HPA057232) | |
Datasheet | Anti FBXL13 pAb (ATL-HPA057232) Datasheet (External Link) |
Vendor Page | Anti FBXL13 pAb (ATL-HPA057232) |