Anti FBP1 pAb (ATL-HPA012513)
Atlas Antibodies
- Catalog No.:
- ATL-HPA012513-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FBP1
Alternative Gene Name: FBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021456: 91%, ENSRNOG00000017637: 93%
Entrez Gene ID: 2203
Uniprot ID: P09467
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDG |
| Gene Sequence | RKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDG |
| Gene ID - Mouse | ENSMUSG00000021456 |
| Gene ID - Rat | ENSRNOG00000017637 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FBP1 pAb (ATL-HPA012513) | |
| Datasheet | Anti FBP1 pAb (ATL-HPA012513) Datasheet (External Link) |
| Vendor Page | Anti FBP1 pAb (ATL-HPA012513) at Atlas Antibodies |
| Documents & Links for Anti FBP1 pAb (ATL-HPA012513) | |
| Datasheet | Anti FBP1 pAb (ATL-HPA012513) Datasheet (External Link) |
| Vendor Page | Anti FBP1 pAb (ATL-HPA012513) |