Anti FBP1 pAb (ATL-HPA012513)

Atlas Antibodies

Catalog No.:
ATL-HPA012513-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: fructose-1,6-bisphosphatase 1
Gene Name: FBP1
Alternative Gene Name: FBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021456: 91%, ENSRNOG00000017637: 93%
Entrez Gene ID: 2203
Uniprot ID: P09467
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDG
Gene Sequence RKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDG
Gene ID - Mouse ENSMUSG00000021456
Gene ID - Rat ENSRNOG00000017637
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FBP1 pAb (ATL-HPA012513)
Datasheet Anti FBP1 pAb (ATL-HPA012513) Datasheet (External Link)
Vendor Page Anti FBP1 pAb (ATL-HPA012513) at Atlas Antibodies

Documents & Links for Anti FBP1 pAb (ATL-HPA012513)
Datasheet Anti FBP1 pAb (ATL-HPA012513) Datasheet (External Link)
Vendor Page Anti FBP1 pAb (ATL-HPA012513)