Anti FBP1 pAb (ATL-HPA005857 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA005857-25

• 
• 

Protein Description: fructose-1,6-bisphosphatase 1
Gene Name: FBP1
Alternative Gene Name: FBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069805: 90%, ENSRNOG00000017597: 88%
Entrez Gene ID: 2203
Uniprot ID: P09467
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAP
• Gene Sequence: DCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAP
• Gene ID - Mouse: ENSMUSG00000069805
• Gene ID - Rat: ENSRNOG00000017597
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FBP1 pAb (ATL-HPA005857 w/enhanced validation) – 7 Found

Brooks, Samira A; Khandani, Amir H; Fielding, Julia R; Lin, Weili; Sills, Tiffany; Lee, Yueh; Arreola, Alexandra; Milowsky, Mathew I; Wallen, Eric M; Woods, Michael E; Smith, Angie B; Nielsen, Mathew E; Parker, Joel S; Lalush, David S; Rathmell, W Kimryn. Alternate Metabolic Programs Define Regional Variation of Relevant Biological Features in Renal Cell Carcinoma Progression. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2016;22(12):2950-9. 

Gutteridge, Rosie Elizabeth Ann; Singh, Chandra K; Ndiaye, Mary Ann; Ahmad, Nihal. Targeted knockdown of polo-like kinase 1 alters metabolic regulation in melanoma. Cancer Letters. 2017;394( 28235541):13-21. 

Lampert, Fabienne; Stafa, Diana; Goga, Algera; Soste, Martin Varis; Gilberto, Samuel; Olieric, Natacha; Picotti, Paola; Stoffel, Markus; Peter, Matthias. The multi-subunit GID/CTLH E3 ubiquitin ligase promotes cell proliferation and targets the transcription factor Hbp1 for degradation. Elife. 2018;7( 29911972) 

Li, Bo; Qiu, Bo; Lee, David S M; Walton, Zandra E; Ochocki, Joshua D; Mathew, Lijoy K; Mancuso, Anthony; Gade, Terence P F; Keith, Brian; Nissim, Itzhak; Simon, M Celeste. Fructose-1,6-bisphosphatase opposes renal carcinoma progression. Nature. 2014;513(7517):251-5. 

Guo, Bin; Huang, Xinxin; Lee, Man Ryul; Lee, Sang A; Broxmeyer, Hal E. Antagonism of PPAR-γ signaling expands human hematopoietic stem and progenitor cells by enhancing glycolysis. Nature Medicine. 2018;24(3):360-367. 

Akhtar, Safia; Culver, Silas A; Siragy, Helmy M. Novel regulation of renal gluconeogenesis by Atp6ap2 in response to high fat diet via PGC1-α/AKT-1 pathway. Scientific Reports. 2021;11(1):11367. 

Liu, Zhijun; You, Yuyu; Chen, Qiyi; Li, Guobang; Pan, Wenfeng; Yang, Qing; Dong, Jiajun; Wu, Yi; Bei, Jin-Xin; Pan, Chaoyun; Li, Fuming; Li, Bo. Extracellular vesicle-mediated communication between hepatocytes and natural killer cells promotes hepatocellular tumorigenesis. Molecular Therapy : The Journal Of The American Society Of Gene Therapy. 2022;30(2):606-620.