Anti FBP1 pAb (ATL-HPA005857 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005857-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FBP1
Alternative Gene Name: FBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069805: 90%, ENSRNOG00000017597: 88%
Entrez Gene ID: 2203
Uniprot ID: P09467
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAP |
| Gene Sequence | DCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAP |
| Gene ID - Mouse | ENSMUSG00000069805 |
| Gene ID - Rat | ENSRNOG00000017597 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FBP1 pAb (ATL-HPA005857 w/enhanced validation) | |
| Datasheet | Anti FBP1 pAb (ATL-HPA005857 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FBP1 pAb (ATL-HPA005857 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FBP1 pAb (ATL-HPA005857 w/enhanced validation) | |
| Datasheet | Anti FBP1 pAb (ATL-HPA005857 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FBP1 pAb (ATL-HPA005857 w/enhanced validation) |
| Citations for Anti FBP1 pAb (ATL-HPA005857 w/enhanced validation) – 7 Found |
| Brooks, Samira A; Khandani, Amir H; Fielding, Julia R; Lin, Weili; Sills, Tiffany; Lee, Yueh; Arreola, Alexandra; Milowsky, Mathew I; Wallen, Eric M; Woods, Michael E; Smith, Angie B; Nielsen, Mathew E; Parker, Joel S; Lalush, David S; Rathmell, W Kimryn. Alternate Metabolic Programs Define Regional Variation of Relevant Biological Features in Renal Cell Carcinoma Progression. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2016;22(12):2950-9. PubMed |
| Gutteridge, Rosie Elizabeth Ann; Singh, Chandra K; Ndiaye, Mary Ann; Ahmad, Nihal. Targeted knockdown of polo-like kinase 1 alters metabolic regulation in melanoma. Cancer Letters. 2017;394( 28235541):13-21. PubMed |
| Lampert, Fabienne; Stafa, Diana; Goga, Algera; Soste, Martin Varis; Gilberto, Samuel; Olieric, Natacha; Picotti, Paola; Stoffel, Markus; Peter, Matthias. The multi-subunit GID/CTLH E3 ubiquitin ligase promotes cell proliferation and targets the transcription factor Hbp1 for degradation. Elife. 2018;7( 29911972) PubMed |
| Li, Bo; Qiu, Bo; Lee, David S M; Walton, Zandra E; Ochocki, Joshua D; Mathew, Lijoy K; Mancuso, Anthony; Gade, Terence P F; Keith, Brian; Nissim, Itzhak; Simon, M Celeste. Fructose-1,6-bisphosphatase opposes renal carcinoma progression. Nature. 2014;513(7517):251-5. PubMed |
| Guo, Bin; Huang, Xinxin; Lee, Man Ryul; Lee, Sang A; Broxmeyer, Hal E. Antagonism of PPAR-γ signaling expands human hematopoietic stem and progenitor cells by enhancing glycolysis. Nature Medicine. 2018;24(3):360-367. PubMed |
| Akhtar, Safia; Culver, Silas A; Siragy, Helmy M. Novel regulation of renal gluconeogenesis by Atp6ap2 in response to high fat diet via PGC1-α/AKT-1 pathway. Scientific Reports. 2021;11(1):11367. PubMed |
| Liu, Zhijun; You, Yuyu; Chen, Qiyi; Li, Guobang; Pan, Wenfeng; Yang, Qing; Dong, Jiajun; Wu, Yi; Bei, Jin-Xin; Pan, Chaoyun; Li, Fuming; Li, Bo. Extracellular vesicle-mediated communication between hepatocytes and natural killer cells promotes hepatocellular tumorigenesis. Molecular Therapy : The Journal Of The American Society Of Gene Therapy. 2022;30(2):606-620. PubMed |