Anti FBN3 pAb (ATL-HPA049482)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049482-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FBN3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024598: 45%, ENSRNOG00000043219: 48%
Entrez Gene ID: 84467
Uniprot ID: Q75N90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LCQGGSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLFGGRCAGDLAGHYTRRQCCC |
| Gene Sequence | LCQGGSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLFGGRCAGDLAGHYTRRQCCC |
| Gene ID - Mouse | ENSMUSG00000024598 |
| Gene ID - Rat | ENSRNOG00000043219 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FBN3 pAb (ATL-HPA049482) | |
| Datasheet | Anti FBN3 pAb (ATL-HPA049482) Datasheet (External Link) |
| Vendor Page | Anti FBN3 pAb (ATL-HPA049482) at Atlas Antibodies |
| Documents & Links for Anti FBN3 pAb (ATL-HPA049482) | |
| Datasheet | Anti FBN3 pAb (ATL-HPA049482) Datasheet (External Link) |
| Vendor Page | Anti FBN3 pAb (ATL-HPA049482) |