Anti FBN3 pAb (ATL-HPA049482)

Atlas Antibodies

Catalog No.:
ATL-HPA049482-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: fibrillin 3
Gene Name: FBN3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024598: 45%, ENSRNOG00000043219: 48%
Entrez Gene ID: 84467
Uniprot ID: Q75N90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LCQGGSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLFGGRCAGDLAGHYTRRQCCC
Gene Sequence LCQGGSCVNMVGSFHCRCPVGHRLSDSSAACEDYRAGACFSVLFGGRCAGDLAGHYTRRQCCC
Gene ID - Mouse ENSMUSG00000024598
Gene ID - Rat ENSRNOG00000043219
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FBN3 pAb (ATL-HPA049482)
Datasheet Anti FBN3 pAb (ATL-HPA049482) Datasheet (External Link)
Vendor Page Anti FBN3 pAb (ATL-HPA049482) at Atlas Antibodies

Documents & Links for Anti FBN3 pAb (ATL-HPA049482)
Datasheet Anti FBN3 pAb (ATL-HPA049482) Datasheet (External Link)
Vendor Page Anti FBN3 pAb (ATL-HPA049482)