Anti FBN2 pAb (ATL-HPA012853 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA012853-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FBN2
Alternative Gene Name: CCA, DA9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024598: 86%, ENSRNOG00000043219: 88%
Entrez Gene ID: 2201
Uniprot ID: P35556
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GMCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDGLPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQ |
| Gene Sequence | GMCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDGLPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQ |
| Gene ID - Mouse | ENSMUSG00000024598 |
| Gene ID - Rat | ENSRNOG00000043219 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FBN2 pAb (ATL-HPA012853 w/enhanced validation) | |
| Datasheet | Anti FBN2 pAb (ATL-HPA012853 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FBN2 pAb (ATL-HPA012853 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FBN2 pAb (ATL-HPA012853 w/enhanced validation) | |
| Datasheet | Anti FBN2 pAb (ATL-HPA012853 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FBN2 pAb (ATL-HPA012853 w/enhanced validation) |
| Citations for Anti FBN2 pAb (ATL-HPA012853 w/enhanced validation) – 4 Found |
| Achilleos, Annita; Huffman, Nichole T; Marcinkiewicyz, Edwidge; Seidah, Nabil G; Chen, Qian; Dallas, Sarah L; Trainor, Paul A; Gorski, Jeff P. MBTPS1/SKI-1/S1P proprotein convertase is required for ECM signaling and axial elongation during somitogenesis and vertebral development†. Human Molecular Genetics. 2015;24(10):2884-98. PubMed |
| Boizot, Jérémy; Minville-Walz, Mélaine; Reinhardt, Dieter Peter; Bouschbacher, Marielle; Sommer, Pascal; Sigaudo-Roussel, Dominique; Debret, Romain. FBN2 Silencing Recapitulates Hypoxic Conditions and Induces Elastic Fiber Impairment in Human Dermal Fibroblasts. International Journal Of Molecular Sciences. 2022;23(3) PubMed |
| Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. PubMed |
| Dekker, Sylvia; van Geemen, Daphne; van den Bogaerdt, Antoon J; Driessen-Mol, Anita; Aikawa, Elena; Smits, Anthal I P M. Sheep-Specific Immunohistochemical Panel for the Evaluation of Regenerative and Inflammatory Processes in Tissue-Engineered Heart Valves. Frontiers In Cardiovascular Medicine. 5( 30159315):105. PubMed |