Anti FBN1 pAb (ATL-HPA017759 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017759-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FBN1
Alternative Gene Name: FBN, MASS, MFS1, OCTD, SGS, WMS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027204: 92%, ENSRNOG00000007302: 91%
Entrez Gene ID: 2200
Uniprot ID: P35555
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HCVSGMGMGRGNPEPPVSGEMDDNSLSPEACYECKINGYPKRGRKRRSTNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISS |
Gene Sequence | HCVSGMGMGRGNPEPPVSGEMDDNSLSPEACYECKINGYPKRGRKRRSTNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISS |
Gene ID - Mouse | ENSMUSG00000027204 |
Gene ID - Rat | ENSRNOG00000007302 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FBN1 pAb (ATL-HPA017759 w/enhanced validation) | |
Datasheet | Anti FBN1 pAb (ATL-HPA017759 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FBN1 pAb (ATL-HPA017759 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti FBN1 pAb (ATL-HPA017759 w/enhanced validation) | |
Datasheet | Anti FBN1 pAb (ATL-HPA017759 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FBN1 pAb (ATL-HPA017759 w/enhanced validation) |
Citations for Anti FBN1 pAb (ATL-HPA017759 w/enhanced validation) – 2 Found |
Fan, Li-Ching; Jeng, Yung-Ming; Lu, Yueh-Tong; Lien, Huang-Chun. SPOCK1 Is a Novel Transforming Growth Factor-β-Induced Myoepithelial Marker That Enhances Invasion and Correlates with Poor Prognosis in Breast Cancer. Plos One. 11(9):e0162933. PubMed |
Han, Tianyu; Guo, Meng; Gan, Mingxi; Yu, Bentong; Tian, Xiaoli; Wang, Jian-Bin. TRIM59 regulates autophagy through modulating both the transcription and the ubiquitination of BECN1. Autophagy. 14(12):2035-2048. PubMed |