Anti FBN1 pAb (ATL-HPA017759 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA017759-25

• 

Protein Description: fibrillin 1
Gene Name: FBN1
Alternative Gene Name: FBN, MASS, MFS1, OCTD, SGS, WMS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027204: 92%, ENSRNOG00000007302: 91%
Entrez Gene ID: 2200
Uniprot ID: P35555
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HCVSGMGMGRGNPEPPVSGEMDDNSLSPEACYECKINGYPKRGRKRRSTNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISS
• Gene Sequence: HCVSGMGMGRGNPEPPVSGEMDDNSLSPEACYECKINGYPKRGRKRRSTNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISS
• Gene ID - Mouse: ENSMUSG00000027204
• Gene ID - Rat: ENSRNOG00000007302
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FBN1 pAb (ATL-HPA017759 w/enhanced validation) – 2 Found

Fan, Li-Ching; Jeng, Yung-Ming; Lu, Yueh-Tong; Lien, Huang-Chun. SPOCK1 Is a Novel Transforming Growth Factor-β-Induced Myoepithelial Marker That Enhances Invasion and Correlates with Poor Prognosis in Breast Cancer. Plos One. 11(9):e0162933. 

Han, Tianyu; Guo, Meng; Gan, Mingxi; Yu, Bentong; Tian, Xiaoli; Wang, Jian-Bin. TRIM59 regulates autophagy through modulating both the transcription and the ubiquitination of BECN1. Autophagy. 14(12):2035-2048.