Anti FBLN5 pAb (ATL-HPA000868)

Atlas Antibodies

SKU: ATL-HPA000868-25

• 

Protein Description: fibulin 5
Gene Name: FBLN5
Alternative Gene Name: ARMD3, DANCE, EVEC, UP50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021186: 95%, ENSRNOG00000050539: 95%
Entrez Gene ID: 10516
Uniprot ID: Q9UBX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGGYLCIPRTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMDESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDEC
• Gene Sequence: QAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGGYLCIPRTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMDESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDEC
• Gene ID - Mouse: ENSMUSG00000021186
• Gene ID - Rat: ENSRNOG00000050539
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FBLN5 pAb (ATL-HPA000868) – 1 Found

Wang, Miao; Topalovski, Mary; Toombs, Jason E; Wright, Christopher M; Moore, Zachary R; Boothman, David A; Yanagisawa, Hiromi; Wang, Huamin; Witkiewicz, Agnieszka; Castrillon, Diego H; Brekken, Rolf A. Fibulin-5 Blocks Microenvironmental ROS in Pancreatic Cancer. Cancer Research. 2015;75(23):5058-69.