Anti FBLN5 pAb (ATL-HPA000868)

Atlas Antibodies

Catalog No.:
ATL-HPA000868-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: fibulin 5
Gene Name: FBLN5
Alternative Gene Name: ARMD3, DANCE, EVEC, UP50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021186: 95%, ENSRNOG00000050539: 95%
Entrez Gene ID: 10516
Uniprot ID: Q9UBX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGGYLCIPRTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMDESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDEC
Gene Sequence QAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGGYLCIPRTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMDESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDEC
Gene ID - Mouse ENSMUSG00000021186
Gene ID - Rat ENSRNOG00000050539
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FBLN5 pAb (ATL-HPA000868)
Datasheet Anti FBLN5 pAb (ATL-HPA000868) Datasheet (External Link)
Vendor Page Anti FBLN5 pAb (ATL-HPA000868) at Atlas Antibodies

Documents & Links for Anti FBLN5 pAb (ATL-HPA000868)
Datasheet Anti FBLN5 pAb (ATL-HPA000868) Datasheet (External Link)
Vendor Page Anti FBLN5 pAb (ATL-HPA000868)
Citations for Anti FBLN5 pAb (ATL-HPA000868) – 1 Found
Wang, Miao; Topalovski, Mary; Toombs, Jason E; Wright, Christopher M; Moore, Zachary R; Boothman, David A; Yanagisawa, Hiromi; Wang, Huamin; Witkiewicz, Agnieszka; Castrillon, Diego H; Brekken, Rolf A. Fibulin-5 Blocks Microenvironmental ROS in Pancreatic Cancer. Cancer Research. 2015;75(23):5058-69.  PubMed