Anti FBLN5 pAb (ATL-HPA000848)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000848-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FBLN5
Alternative Gene Name: ARMD3, DANCE, EVEC, UP50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021186: 92%, ENSRNOG00000050539: 93%
Entrez Gene ID: 10516
Uniprot ID: Q9UBX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TYFCSCPPGYILLDDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMCPAENPGCRDQPFTILYRDMDVVSGRSVPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPR |
| Gene Sequence | TYFCSCPPGYILLDDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMCPAENPGCRDQPFTILYRDMDVVSGRSVPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPR |
| Gene ID - Mouse | ENSMUSG00000021186 |
| Gene ID - Rat | ENSRNOG00000050539 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FBLN5 pAb (ATL-HPA000848) | |
| Datasheet | Anti FBLN5 pAb (ATL-HPA000848) Datasheet (External Link) |
| Vendor Page | Anti FBLN5 pAb (ATL-HPA000848) at Atlas Antibodies |
| Documents & Links for Anti FBLN5 pAb (ATL-HPA000848) | |
| Datasheet | Anti FBLN5 pAb (ATL-HPA000848) Datasheet (External Link) |
| Vendor Page | Anti FBLN5 pAb (ATL-HPA000848) |
| Citations for Anti FBLN5 pAb (ATL-HPA000848) – 3 Found |
| Winship, Amy Louise; Rainczuk, Kate; Ton, Amanda; Dimitriadis, Eva. Fibulin-5 localisation in human endometrial cancer shifts from epithelial to stromal with increasing tumour grade, and silencing promotes endometrial epithelial cancer cell proliferation. Oncology Letters. 2016;12(1):651-657. PubMed |
| Charoenchon, Nisamanee; Rhodes, Lesley E; Pilkington, Suzanne M; Farrar, Mark D; Watson, Rachel E B. Differential reorganisation of cutaneous elastic fibres: a comparison of the in vivo effects of broadband ultraviolet B versus solar simulated radiation. Photochemical & Photobiological Sciences : Official Journal Of The European Photochemistry Association And The European Society For Photobiology. 2018;17(7):889-895. PubMed |
| Heidegger, Isabel; Fotakis, Georgios; Offermann, Anne; Goveia, Jermaine; Daum, Sophia; Salcher, Stefan; Noureen, Asma; Timmer-Bosscha, Hetty; Schäfer, Georg; Walenkamp, Annemiek; Perner, Sven; Beatovic, Aleksandar; Moisse, Matthieu; Plattner, Christina; Krogsdam, Anne; Haybaeck, Johannes; Sopper, Sieghart; Thaler, Stefanie; Keller, Markus A; Klocker, Helmut; Trajanoski, Zlatko; Wolf, Dominik; Pircher, Andreas. Comprehensive characterization of the prostate tumor microenvironment identifies CXCR4/CXCL12 crosstalk as a novel antiangiogenic therapeutic target in prostate cancer. Molecular Cancer. 2022;21(1):132. PubMed |