Anti FBLN1 pAb (ATL-HPA001613 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001613-25

• 
• 

Protein Description: fibulin 1
Gene Name: FBLN1
Alternative Gene Name: FBLN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006369: 94%, ENSRNOG00000014137: 94%
Entrez Gene ID: 2192
Uniprot ID: P23142
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NTLGSYLCSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAFECPEN
• Gene Sequence: NTLGSYLCSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAFECPEN
• Gene ID - Mouse: ENSMUSG00000006369
• Gene ID - Rat: ENSRNOG00000014137
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FBLN1 pAb (ATL-HPA001613 w/enhanced validation) – 3 Found

Kanda, Mitsuro; Nomoto, Shuji; Okamura, Yukiyasu; Hayashi, Masamichi; Hishida, Mitsuhiro; Fujii, Tsutomu; Nishikawa, Yoko; Sugimoto, Hiroyuki; Takeda, Shin; Nakao, Akimasa. Promoter hypermethylation of fibulin 1 gene is associated with tumor progression in hepatocellular carcinoma. Molecular Carcinogenesis. 2011;50(8):571-9. 

Neiman, Maja; Hedberg, Jesper J; Dönnes, Pierre R; Schuppe-Koistinen, Ina; Hanschke, Stephan; Schindler, Ralf; Uhlén, Mathias; Schwenk, Jochen M; Nilsson, Peter. Plasma profiling reveals human fibulin-1 as candidate marker for renal impairment. Journal Of Proteome Research. 2011;10(11):4925-34. 

Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038.