Anti FBLN1 pAb (ATL-HPA001612 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001612-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FBLN1
Alternative Gene Name: FBLN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006369: 92%, ENSRNOG00000014137: 93%
Entrez Gene ID: 2192
Uniprot ID: P23142
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNE |
| Gene Sequence | CESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNE |
| Gene ID - Mouse | ENSMUSG00000006369 |
| Gene ID - Rat | ENSRNOG00000014137 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FBLN1 pAb (ATL-HPA001612 w/enhanced validation) | |
| Datasheet | Anti FBLN1 pAb (ATL-HPA001612 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FBLN1 pAb (ATL-HPA001612 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FBLN1 pAb (ATL-HPA001612 w/enhanced validation) | |
| Datasheet | Anti FBLN1 pAb (ATL-HPA001612 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FBLN1 pAb (ATL-HPA001612 w/enhanced validation) |
| Citations for Anti FBLN1 pAb (ATL-HPA001612 w/enhanced validation) – 2 Found |
| Kalamarides, M; Stemmer-Rachamimov, A O; Niwa-Kawakita, M; Chareyre, F; Taranchon, E; Han, Z-Y; Martinelli, C; Lusis, E A; Hegedus, B; Gutmann, D H; Giovannini, M. Identification of a progenitor cell of origin capable of generating diverse meningioma histological subtypes. Oncogene. 2011;30(20):2333-44. PubMed |
| Neiman, Maja; Hedberg, Jesper J; Dönnes, Pierre R; Schuppe-Koistinen, Ina; Hanschke, Stephan; Schindler, Ralf; Uhlén, Mathias; Schwenk, Jochen M; Nilsson, Peter. Plasma profiling reveals human fibulin-1 as candidate marker for renal impairment. Journal Of Proteome Research. 2011;10(11):4925-34. PubMed |