Anti FAU pAb (ATL-HPA059015)

Atlas Antibodies

Catalog No.:
ATL-HPA059015-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
Gene Name: FAU
Alternative Gene Name: asr1, FLJ22986, Fub1, Fubi, MNSFbeta, RPS30, S30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038274: 100%, ENSRNOG00000046393: 100%
Entrez Gene ID: 2197
Uniprot ID: P35544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KTGRAKRRMQYNRRFVNVVPTFGKKKGPNAN
Gene Sequence KTGRAKRRMQYNRRFVNVVPTFGKKKGPNAN
Gene ID - Mouse ENSMUSG00000038274
Gene ID - Rat ENSRNOG00000046393
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAU pAb (ATL-HPA059015)
Datasheet Anti FAU pAb (ATL-HPA059015) Datasheet (External Link)
Vendor Page Anti FAU pAb (ATL-HPA059015) at Atlas Antibodies

Documents & Links for Anti FAU pAb (ATL-HPA059015)
Datasheet Anti FAU pAb (ATL-HPA059015) Datasheet (External Link)
Vendor Page Anti FAU pAb (ATL-HPA059015)