Anti FAU pAb (ATL-HPA059015)

Atlas Antibodies

SKU: ATL-HPA059015-100

• 
• 
• 

Protein Description: Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
Gene Name: FAU
Alternative Gene Name: asr1, FLJ22986, Fub1, Fubi, MNSFbeta, RPS30, S30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038274: 100%, ENSRNOG00000046393: 100%
Entrez Gene ID: 2197
Uniprot ID: P35544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KTGRAKRRMQYNRRFVNVVPTFGKKKGPNAN
• Gene Sequence: KTGRAKRRMQYNRRFVNVVPTFGKKKGPNAN
• Gene ID - Mouse: ENSMUSG00000038274
• Gene ID - Rat: ENSRNOG00000046393
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.