Anti FAU pAb (ATL-HPA059015)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059015-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: FAU
Alternative Gene Name: asr1, FLJ22986, Fub1, Fubi, MNSFbeta, RPS30, S30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038274: 100%, ENSRNOG00000046393: 100%
Entrez Gene ID: 2197
Uniprot ID: P35544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KTGRAKRRMQYNRRFVNVVPTFGKKKGPNAN |
Gene Sequence | KTGRAKRRMQYNRRFVNVVPTFGKKKGPNAN |
Gene ID - Mouse | ENSMUSG00000038274 |
Gene ID - Rat | ENSRNOG00000046393 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FAU pAb (ATL-HPA059015) | |
Datasheet | Anti FAU pAb (ATL-HPA059015) Datasheet (External Link) |
Vendor Page | Anti FAU pAb (ATL-HPA059015) at Atlas Antibodies |
Documents & Links for Anti FAU pAb (ATL-HPA059015) | |
Datasheet | Anti FAU pAb (ATL-HPA059015) Datasheet (External Link) |
Vendor Page | Anti FAU pAb (ATL-HPA059015) |