Anti FAU pAb (ATL-HPA059015)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059015-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: FAU
Alternative Gene Name: asr1, FLJ22986, Fub1, Fubi, MNSFbeta, RPS30, S30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038274: 100%, ENSRNOG00000046393: 100%
Entrez Gene ID: 2197
Uniprot ID: P35544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KTGRAKRRMQYNRRFVNVVPTFGKKKGPNAN |
| Gene Sequence | KTGRAKRRMQYNRRFVNVVPTFGKKKGPNAN |
| Gene ID - Mouse | ENSMUSG00000038274 |
| Gene ID - Rat | ENSRNOG00000046393 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAU pAb (ATL-HPA059015) | |
| Datasheet | Anti FAU pAb (ATL-HPA059015) Datasheet (External Link) |
| Vendor Page | Anti FAU pAb (ATL-HPA059015) at Atlas Antibodies |
| Documents & Links for Anti FAU pAb (ATL-HPA059015) | |
| Datasheet | Anti FAU pAb (ATL-HPA059015) Datasheet (External Link) |
| Vendor Page | Anti FAU pAb (ATL-HPA059015) |