Anti FATE1 pAb (ATL-HPA034604 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA034604-25

Protein Description: fetal and adult testis expressed 1
Gene Name: FATE1
Alternative Gene Name: CT43, FATE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053593: 45%, ENSRNOG00000050457: 26%
Entrez Gene ID: 89885
Uniprot ID: Q969F0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATW
• Gene Sequence: GSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATW
• Gene ID - Mouse: ENSMUSG00000053593
• Gene ID - Rat: ENSRNOG00000050457
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FATE1 pAb (ATL-HPA034604 w/enhanced validation) – 4 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88. 

Maxfield, Kimberly E; Taus, Patrick J; Corcoran, Kathleen; Wooten, Joshua; Macion, Jennifer; Zhou, Yunyun; Borromeo, Mark; Kollipara, Rahul K; Yan, Jingsheng; Xie, Yang; Xie, Xian-Jin; Whitehurst, Angelique W. Comprehensive functional characterization of cancer-testis antigens defines obligate participation in multiple hallmarks of cancer. Nature Communications. 2015;6( 26567849):8840. 

Gallegos, Zachary R; Taus, Patrick; Gibbs, Zane A; McGlynn, Kathleen; Gomez, Nicholas C; Davis, Ian; Whitehurst, Angelique W. EWSR1-FLI1 Activation of the Cancer/Testis Antigen FATE1 Promotes Ewing Sarcoma Survival. Molecular And Cellular Biology. 2019;39(14)