Anti FATE1 pAb (ATL-HPA034604 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
 - ATL-HPA034604-25
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $303.00
    
         
                            Gene Name: FATE1
Alternative Gene Name: CT43, FATE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053593: 45%, ENSRNOG00000050457: 26%
Entrez Gene ID: 89885
Uniprot ID: Q969F0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | GSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATW | 
| Gene Sequence | GSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATW | 
| Gene ID - Mouse | ENSMUSG00000053593 | 
| Gene ID - Rat | ENSRNOG00000050457 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti FATE1 pAb (ATL-HPA034604 w/enhanced validation) | |
| Datasheet | Anti FATE1 pAb (ATL-HPA034604 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti FATE1 pAb (ATL-HPA034604 w/enhanced validation) at Atlas Antibodies | 
| Documents & Links for Anti FATE1 pAb (ATL-HPA034604 w/enhanced validation) | |
| Datasheet | Anti FATE1 pAb (ATL-HPA034604 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti FATE1 pAb (ATL-HPA034604 w/enhanced validation) | 
| Citations for Anti FATE1 pAb (ATL-HPA034604 w/enhanced validation) – 4 Found | 
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed | 
| Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88. PubMed | 
| Maxfield, Kimberly E; Taus, Patrick J; Corcoran, Kathleen; Wooten, Joshua; Macion, Jennifer; Zhou, Yunyun; Borromeo, Mark; Kollipara, Rahul K; Yan, Jingsheng; Xie, Yang; Xie, Xian-Jin; Whitehurst, Angelique W. Comprehensive functional characterization of cancer-testis antigens defines obligate participation in multiple hallmarks of cancer. Nature Communications. 2015;6( 26567849):8840. PubMed | 
| Gallegos, Zachary R; Taus, Patrick; Gibbs, Zane A; McGlynn, Kathleen; Gomez, Nicholas C; Davis, Ian; Whitehurst, Angelique W. EWSR1-FLI1 Activation of the Cancer/Testis Antigen FATE1 Promotes Ewing Sarcoma Survival. Molecular And Cellular Biology. 2019;39(14) PubMed |